Would you like to draw me, here are some pics of
me! Also check out my other slideshow videos for
more pictures! :) Tags :PicturesDrawMePleaseSlideShow
What do you do with fresh McDonald's French Fries
and 10 packets of Ketchup? You paint with them of
course. 50 min speed painting plays in 4 mins.
Ketchup as paint and french fries as a paint
brush.
I had to remove the original song because of
copyright infringement. Unfortunately the YouTube
AudioSwap beta also reduced the quality of the
video. When I get a chance I will upload a new
higher quality video. I am also in the process of
having some limited edition posters and artist
prints made. I will be selling these prints on
ebay to raise money for the CARE World Hunger
Campaign.
Please check out my other videos where I draw with
more traditional mediums. Coming in April I am
starting a series of instructional videos on how
to draw portraits. I am also holding a contest on
YouTube soon to win your own portrait. So
subscribe to my channel to keep updated.
Now to answer some questions..
The painting Measures 14x11 inches on foamcore
surface. It is not permanent the video is the
art.
I do custom portraits in a variety of mediums.
You can find some info at
http://www.EclecticAsylum.com Tags :speedpaintingketchupcatsupfrenchfriesdrawingtimelapseeclecticasylumsupersizememcdonaldsmcdonaldmickeylost
lets try to beat EclecticAsylum in what he does
the best of all: drawing!!!
Is it possible to draw something better? Your
opinion will decide! VOTE! Tags :artartistdrawingpaintshoplittlelocaEclecticAsylum
büyük şehir belediyesi bakırköy belediyesi
kültür sanat ile ilgili çalışmalarını
sanatcıları arasına alarak yapmalı resim
dersleri bakırköy kültür merkezleri
atölyeleri sanat çalışmaları carusel
alışveriş merkezi arkası zeytinlik mah dadyan
sokak no 3 capasity alışveriş merkezine 30
adım irtibat 05384244231 nilüfer hanım kara
kalem portre ressam grafik eclecticasylum art
korkunç kazalar şakalar gol komik dizisi
draw müzik çizimi kara kalem portre çizim
cizenler Tags :karakalemportreressamgrafikeclecticasylumartkorkunçkazalarşakalargolkomikdizisidrawmüzik
Long before the monkeys were fixing problems at
YouTube they were teaching bicycle safety at
schools.
This is an old clasroom teaching reel from 1963.
This was before LSD but... What were these people
thinking when they made this?
I collect old reels and I'll upload them as I get
a chance.
This is certified public domain by The Library of
Congress and Creative Commons Tags :bicyclesafetyfilmreelmonkeysbikeweirdyoutubeclassroomteachinghowto
A tribute I made to EclecticAsylum, but changed to
accomidate my skill, or lack thereof.
Actually, I did it to suck up to him so he'd draw
me. Evryone like a poser, right?
Right???
Oh, and here's a link to the music file, for
anyone who wants it:
http://www.albinoblacksheep.com/audio/blackbeard Tags :drawingthewinekoneportraitmarkerstimelapsespeeddrawarteclecticasylumjasonbaalmaneclecticpopularpop
youtube de sanat derslerimiz sanat haberlerimiz
02125712403 kültür merkezimiz devreye girdi
youtube haberler ve sanat haberleri güncel olarak
izliyebilirsiniz bakırköy merkezde resim
dersleri başladı 05376318871 duvar resmi kara
kalem portre ressam grafik eclecticasylum art
korkunç kazalar şakalar gol komik dizisi
draw müzik çizimi Tags :karakalemportreressamgrafikeclecticasylumartkorkunçkazalarşakalargolkomikdizisidrawmüzik